tripal / tripal_blast Goto Github PK
View Code? Open in Web Editor NEWProvides an user interface to BLAST on Tripal sites.
Home Page: https://tripal.github.io/tripal_blast/
Provides an user interface to BLAST on Tripal sites.
Home Page: https://tripal.github.io/tripal_blast/
When you go to Tripal Admin > Extensions, you get an "Access denied" if Tripal Blast is the only extension module installed. If other extension modules are installed then you may see a listing on this page but it will not include the Tripal Blast link.
This is due to tighter access permissions in Drupal 10.2 which ensures you do not see the listing page if you don't have access to any child pages. There is currently some issue with the permissions on the Tripal Blast administration pages that are causing this.
The Tripal Blast configuration is still available despite this issue. You just need to access it using the URL directly SITE/admin/tripal/extension/tripal_blast
. This is where you add your BLAST databases in order to have them show up in the UI drop-down for target database.
I updated the version of this module to 7.x-1.3 and under PHP8 the following warnings are shown immediately after upgrade
Deprecated function: Required parameter $scores follows optional parameter $acc in require_once() (line 24 of .../sites/all/modules/tripal_blast/blast_ui.module).
Deprecated function: Required parameter $hits follows optional parameter $acc in require_once() (line 24 of .../sites/all/modules/tripal_blast/blast_ui.module).
Deprecated function: Required parameter $tsize follows optional parameter $acc in require_once() (line 24 of .../sites/all/modules/tripal_blast/blast_ui.module).
Deprecated function: Required parameter $qsize follows optional parameter $acc in require_once() (line 24 of .../sites/all/modules/tripal_blast/blast_ui.module).
Deprecated function: Required parameter $name follows optional parameter $acc in require_once() (line 24 of .../sites/all/modules/tripal_blast/blast_ui.module).
This was not introduced in this version, so I am not exactly sure why it wasn't showing up before, but regardless the fix is simple.
/update.php?op=info
to see these warnings.We NEED current documentation for the upgraded version of this module!
I started this with PR #103 and am now creating this issue to document the process.
That PR adds a skeleton of documentation for this module (more a plan then actual documentation at this point) using mkdocs and the Material Theme.
How to develop these docs:
cd docs
docker build --tag trpblast:docs ./
docker run --rm --volume=$(pwd):/tripal_blast trpblast:docs mkdocs build
open site/index.html
To see something like the following:
And the current navigation is:
I ran the amino acid translation of https://www.ncbi.nlm.nih.gov/nuccore/XM_003602825.2 in a tblastn against Glycine Max: DFCI indicies version 16 through knowpulse and got the following error:
"We encountered an error and are unable to load your BLAST results."
The blast command was:
tblastn -max_target_seqs 20000 -evalue 0.001 -word_size 3 -gapopen 7 -gapextend 2 -culling_limit 0 -matrix PAM30
I'm wondering if space inclusion in the sequence lines is causing an error after the sequence is passed to the backend. This could also be related to culling_limit 0 depending on blast version.
Thank you, knowpulse looks really neat
At line 202 of api/blast_ui.api.inc there is an overly aggressive regex
// Strip the extension off the BLAST target
$database = preg_replace("/(.*)\.[pn]\w\w$/", '$1', $database);
which I think should be removed. It caused my database with a name of the format xxxxxx.pep
(i.e. xxxxxx.pep.psq, xxxxxx.pep.pin, etc.) to have the .pep stripped off and tripal_blast died ungracefully. It seems to also fail if the extension is included in the admin page, so I am not sure that this regex is doing what was obviously intended. Workaround is to not name databases with a pattern that matches this regex. e.g. "xxxxxx.peptide"
I feel that the blast output controls are not clear, they are inconsistent with a lot of current conventions. Currently,
▼ means can be expanded
▲ means has been expanded (can be closed)
example below at "Before"
I propose changing them to those used by Windows 10+, and in fact used at their design site https://learn.microsoft.com/en-us/windows/apps/design/ on the left side.
˃ means can be expanded
˅ means has been expanded (can be closed)
Under PHP8, a parameter passed to a function with a different name than expected causes an error
Calling: run_BLAST_tripal_job(blastp, /tmp/2023Feb11_094532_query.fasta, .../filename.peptide, sites/default/files/tripal_blast/2023Feb11_094532.blast, Array)
WD php: Error: Unknown named parameter $output_filename in TripalJob->run() (line 341 of [error]
/var/www/2020-02-18/drupal-7.69/sites/all/modules/tripal/tripal/includes/TripalJob.inc).
Expected parameters in the function definition:
function run_BLAST_tripal_job($program, $query, $database, $output_filestub, $options, $job_id = NULL)
but in file includes/blast_ui.form_per_program.inc
line 551
'output_filename' => $output_filestub,
A simple fix
Sometimes it's helpful to get the hit sequence rather than just the hit locations. This might be doable via blast_formatter by creating a custom table output which includes qseq (aligned part of query sequence) and sseq (aligned part of subject sequence) in the table download.
With #35 I have begun creating PHPUnit tests for this module using the TripalTestSuite. 🎉
This issue is a place to discuss where to start and any other philosophy related to tests :-)
First up, I asked for guidance in #35: specifically,
I would love input on where to go from here! :-) Should I
- continue on with more complete testing of the blastdb node (used as the template in the blast form)
- test each API function (api/blast_ui.api.inc) independently
- focus on the blast form everyone uses ;-p
@bradfordcondon replied with
What would be cool is if you installed blast on the travis environment and somehow thought of a smart way to loop through all the option combos presented in the blastn form and submitted a blast job with them, ensuring no errors. That has some tricky things though (some options are AJAX-dependent).
Otherwise try to focus on the "end points" of the module. So API functions that are true API functions (we expect them to be called by anything else) are great places to start.
Any other input? @ekcannon? I'm tempted to go with the ambitious suggestion by @bradfordcondon since I feel this would be the most useful testing but I also don't want to bite off more then I can chew ;-p
Hello,
I was wondering if there's a way to change the styling of the generated Jbrowse blast track.
./includes/blast_ui.linkouts.inc: $jbrowse_query['addTracks'] = 'addTracks=[{"label":"blast","key":"BLAST Result","type":"JBrowse/View/Track/HTMLFeatures","store":"url"}]';
We've added arrows for orientation of our JBrowse tracks (for our features), and want to do the same for the blast result. We've done it for our tracks by setting the type to "Canvas Feature" and setting the style properties from there.
Does the module already provide a way to do this?
Cheers
B
I commented out the following line of code after noticing the following error:
Notice: Undefined variable: db_file_id in blast_ui_per_blast_program_form() (line 254 of /var/www/html/sites/all/modules/tripal_blast/includes/blast_ui.form_per_program.inc).
If you click on any blast program other than blastn, you get a WSOD error.
Specific links that cause error:
This is caused by missing services providing alterations for these forms. To fix we will use TripalBlastProgramBlastn as a template to upgrade the other forms from the previous version: blastx, tblastn, blastp.
I need to look at this a bit more closely, but a user just reported this to me today.
This is using tblastn:
This is the display of two hsps:
Here is the output in the html blast output:
Score = 138 bits (308), Expect(2) = 2e-58, Method: Compositional matrix adjust.
Identities = 62/64 (97%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
Frame = -2
Query 47 FSAGPRVCLGENLARMELFLFFTSLLQRFQFYWPDPASKPNLEPKYQFTQAPQPYKMGVR 106
S GPRVCLGENLARMELFLFFTSLLQRFQFYWPDPASKPNLEPKYQFTQAPQPYKMGVR
Sbjct 1996088 LSPGPRVCLGENLARMELFLFFTSLLQRFQFYWPDPASKPNLEPKYQFTQAPQPYKMGVR 1995909
Query 107 PRNS 110
PRNS
Sbjct 1995908 PRNS 1995897
Score = 110 bits (244), Expect(2) = 2e-58, Method: Compositional matrix adjust.
Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
Frame = -2
Query 1 PQGIIILPNFTSVLFDESQWESPHEFNPGHFLDSSGKFVKPDAFLVFSAG 50
PQGIIILPNFTSVLFDESQWESPHEFNPGHFLDSSGKFVKPDAFLVFSAG
Sbjct 1996358 PQGIIILPNFTSVLFDESQWESPHEFNPGHFLDSSGKFVKPDAFLVFSAG 1996209```
The subject coordinates are not displayed the same on the results page as they are reported in the html output. It appears that the the correct start coordinate has been swapped with the displayed end coord, but I don't know what has happened to the correct end coord. Could this have something to do with the this being in the minus frame?
Sofia
Hello!
We recently encountered an issue where the blast database won't be found if the path contained a space at the beginning or the end.
For exmple, the path "/var/www/html/sites/default/files/bdb/quercus_robur/Qrob_PM1N_CDS_aa_20161004.fa
" is treated differently that "/var/www/html/sites/default/files/bdb/quercus_robur/Qrob_PM1N_CDS_aa_20161004.fa
"
Where the second one has a space at the end.
A simple trim($path)
should fix this.
Thanks!
Hi all,
dont know if this issue will stay relevant for Tripal 3 version.
We have a problem where the blast databases are being indexed by elasticsearch. Tripal ES indexes all nodes that an anonymous user would have access to. These nodes arent really fit for end user consumption (http://160.36.205.61:8095/node/1976613).
Is it possible to change the view permissions for these nodes? It seems like permissions are only defined for CRUD
When I try to enable "CViTjs" via Home -> Admin -> Tripal -> Extensions. I am getting the following message
Warning: Undefined array key "cvitjs_location" in blast_ui_admin_form_submit() (line 329 of /var/www/html/teak-wood-genes-drupal7/sites/all/modules/tripal_blast/includes/blast_ui.admin.inc).
My cvitjs folder and the data folder exist as follows
I am also adding the file
blast_ui.admin.inc.txt
Hi!
I've been having the following error when running BLAST jobs in the command line, and any help is much appreciated. Thanks in advance!
Executing tblastn
Query: /tmp/2019Sep17_125610_query.fasta
Database: /home/ubi/corkoak/corkoak_blastdb/corkoak_nucldb
Results File: sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn
Options:
max_target_seqs: 500
evalue: 0.001
word_size: 3
gapopen: 11
gapextend: 1
matrix: BLOSUM62
Executing the following BLAST command:
'/home/ubi/software/ncbi-blast-2.8.1+/bin/tblastn' -query '/tmp/2019Sep17_125610_query.fasta' -db '/home/ubi/corkoak/corkoak_blastdb/corkoak_nucldb' -out 'sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn' -outfmt=11 -'max_target_seqs' '500' -'evalue' '0.001' -'word_size' '3' -'gapopen' '11' -'gapextend' '1' -'matrix' 'BLOSUM62' -num_threads '1'
Command line argument error: Argument "query". File is not accessible: `/tmp/2019Sep17_125610_query.fasta'
Generating additional download formats...
XML
Executing '/home/ubi/software/ncbi-blast-2.8.1+/bin/blast_formatter' -archive 'sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn' -outfmt 5 -out 'sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.xml'
Command line argument error: Argument "query". File is not accessible: `/tmp/2019Sep17_125610_query.fasta'
ERROR (BLAST_UI): Unable to convert BLAST ASN.1 archive to XML (sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn => sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.xml).
[site http://corkoakdb.org] [TRIPAL ERROR] [BLAST_UI] Unable to convert BLAST ASN.1 archive to XML (sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn => sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.xml).
Tab-delimited
Executing '/home/ubi/software/ncbi-blast-2.8.1+/bin/blast_formatter' -archive 'sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn' -outfmt 7 -out 'sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.tsv'
Command line argument error: Argument "query". File is not accessible: `/tmp/2019Sep17_125610_query.fasta'
WARNING (BLAST_UI): Unable to convert BLAST ASN.1 archive to Tabular Output (sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn => sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.tsv).
[site http://corkoakdb.org] [TRIPAL WARNING] [BLAST_UI] Unable to convert BLAST ASN.1 archive to Tabular Output (sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.asn => sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.tsv).
GFF
fopen(sites/default/files/tripal/tripal_blast/2019Sep17_125610.blast.tsv): failed to open stream: No such file or directory blast_ui.api.inc:764 [warning]
Unable to open tsv file!Drush command terminated abnormally due to an unrecoverable error.
The online documentation for has outdated formatting instructions for the most recent blast++. Also, if you don't set aside enough memory for your site you get an error message when loading blast results that simply says the page can't be loaded, there is no meaningful message in the Drupal logs. I came across this looking in the server logs. We recommend 2GB of RAM for Tripal but if the user skipped that they will get this message. It might be good to just add a blurb about making sure you have enough memory configured for the site in the docs.
Original Issue by @oklonova posted here: tripal/tripal#414
Hi,
I have installed BLAST UI module and followed the instructions in the README file: installed NCBI BLAST+, downloaded a database from NCBI using update_blastdb.pl script, and added it as a node to blast against, proving the path.
The path to the ncbi-blast+/bin is added in the settings.
The NCBI BLAST+ is at /home/user/ncbi-blast-2.7.1+ (I am having a test Tripal web site running locally).
The database is in sites/default/files/blastdb.
Whenever I want to use this module, I get the following message:
"Notice: Undefined variable: db_file_id in blast_ui_per_blast_program_form() (line 254 of /var/www/html/sites/all/modules/tripal_blast/includes/blast_ui.form_per_program.inc)",
even if I am just checking the box to show an example sequence and upload a fasta file to blast against (without using any database).
Does this have anything to do with the placement of the NCBI and the database files?
I also wonder how I can blast against my local Tripal/Chado database (provide this option in the list of databases that appear under "Select a Dataset" button).
Any help or hint would be very much appreciated.
hi there!
I'm trying to make the blast module work,
by now I've done:
apparently everything is fine. The thing is.. what to do next to see somewhere the BLAST tool page?
it must be biting me, but I cant find the way.
Thanks a lot
Hi,
which path should I provide to the local database? (currently it is a small database on localhost)
localhost/chado does not work, obviously. I want to be able to blast against this database.
I am getting error messages, guess they are connected to the wrong path:
Notice: Undefined variable: blastdb_with_suffix in blast_ui_per_blast_program_form_submit() (line 502 of /var/www/html/sites/all/modules/tripal_blast/includes/blast_ui.form_per_program.inc).
Notice: Undefined variable: db_file_id in blast_ui_per_blast_program_form() (line 254 of /var/www/html/sites/all/modules/tripal_blast/includes/blast_ui.form_per_program.inc).
Work on this has been begun by @reynoldtan on branch 9.x-2.x. We have a PR open #81 for testing of the current upgrade and would appreciate feedback on this issue or the PR if you are interested in using this module for Tripal 4.
Quoted from Drupal.org, Issue filed by Nate Henry
Problem/Motivation
The field that where the FASTA sequence is entered does not:
- Check for a space after the ">" and the id
- Wrong letters are acceptable (regex only checks first letter)
- Does not require description line (not sure if this is required)
Proposed resolution
I rewrote the function
validate_fasta_sequence
with the following design constraints.
- A description line must be included.
- A single ">" will be accepted as a description line. The function header comment (in
blast_ui.api.inc
) states that both the identifier and description are optional- If an identifier is given, there must be no space between ">" and the identifier. Spaces after the identifier are acceptable until the end of the line.
- The amino acid/ and nucleic acids sequences will be checked. Spaces are allowed. Numbers are not allowed.
- A blank line is not allowed (as stated in by NCBI).
- The validation should work on more than one description/sequence pair
<?php function validate_fasta_sequence($type, $sequence) { $fastaVerRegEx = ''; if ($type == 'nucleotide') { $fastaVerRegEx = '/^[acgntuACGNTU\n\r\s]*$/'; } elseif ($type == 'protein') { $fastaVerRegEx = '/^[acgturykmswbdhvnxACGTURYKMSWBDHVNX\*\-\n\r\s]*$/'; } $fastaSeqMatch = array(); $fastaIdRegEx = '/^[\s\n\r\t]*>((?!\s)(.+?)*|)[\n\r]/'; $fastaSeqRegExSingle = '/[\n\r].*/s'; $fastaSeqRegEx = '/[\n\r](.*?|[\n\r])>/s'; $seqPart = $sequence; while(TRUE) { // Check for valid description line and make sure there are no blank lines if(preg_match($fastaIdRegEx,$seqPart,$temp) && !(preg_match('/[\n]\s*[\n]/',$seqPart))) { // One sequence to process if (!(preg_match($fastaSeqRegEx,$seqPart,$fastaSeqMatch))) { preg_match($fastaSeqRegExSingle,$seqPart,$fastaSeqMatch); $fastaSeqMatch = implode("", $fastaSeqMatch); if(preg_match($fastaVerRegEx,$fastaSeqMatch)) { return FALSE; } else { return TRUE; } } // Multiple sequences to process if (preg_match($fastaSeqRegEx,$seqPart,$fastaSeqMatch)) { if(preg_match($fastaVerRegEx,$fastaSeqMatch[1])) { // Remove top description line and sequence $firstNewLine = strpos($seqPart,'>',1); $seqPart = substr($seqPart,$firstNewLine); } else { return TRUE; } } } else { return TRUE; } } }
Remaining tasks
The regex expression used to check for a blank line
/[\n]\s*[\n]/
does not include the line escape character. For some reason,/[\n\r]\s*[\n\r]/
did not work. Since this function is not called to parse an uploaded FASTA file, this may not matter.Included is a patch that can be run from the tripal_blast directory.
Hi.
Yesterday Blast module was working great. This morning, no blast jobs will run, trpjob-daemon dies, and I get these errors
PHP Notice: Undefined property: Core_Plugin_ProcessManager::$daemon in /var/www/html/sites/all/libraries/PHP-Daemon/Core/Plugin/ProcessManager.php on line 60 pid 31698
PHP Fatal error: Call to a member function is() on a non-object in /var/www/html/sites/all/libraries/PHP-Daemon/Core/Plugin/ProcessManager.php on line 60
Not unexpectedly, I also get a bunch of other errors also due to the asn file not being created.
I can run the same requested blast job on the command line, so I know the input fasta is okay and the database is okay, and that blast can still make the asn files. I still have lots of free space on the server.
I did not make any changes between yesterday and today. I have not made any changes in over a week.
Thank you,
Sofia
Composer is the recommended method of installation of extension modules in Drupal 10.
We do not yet have a composer.json file in this module nor do we have a page on packagist to allow site admin to install this module via composer 🙈
The current docs show a work around to this:
And this issue is here to remind us to configure this module to work with composer and to update the docs once that is done.
Hi,
Blast UI jobs do not start automatically, I have to do it manually in the job list or via the command line.
"Results list" appears, but there is only the message "Your BLAST has been registered and will be started shortly. This page will automatically refresh". The page refreshes without any results.
For installation, I followed the instructions on the project page. Everything worked perfectly until now (I was away for a month).
Do you have a hint where to look?
Drupal 7.61
Drush Daemon API 7-2.3
Tripal 2
Tripal Jobs Daemon 7-1
Best regards,
Olga
Hi, I am interested in making a database from fasta files (one with proteins, other with nucleotides -mRNAs). I'm reading the docs, and its adviced to do with formatdb command. My question is.. which is the difference between doing it with formatdb and makeblastdb for this purpose? will this affect in the functioning of the module somehow?
Thanks!
We missed a warning when creating the CViTjs functionality. As reported by @oklonova:
A warning on top of Tripal BLAST UI settings page:
Warning: file_get_contents(/cvit.conf): failed to open stream: No such file or directory in blast_ui_get_cvit_conf_text() (line 891 of /var/www/html/sites/all/modules/tripal_blast/api/blast_ui.api.inc).
I do not need genome views, as it is so far a protein-only database. CViTjs is not enabled. I wonder why it is there.
This is likely due to https://github.com/tripal/tripal_blast/blob/7.x-1.x/includes/blast_ui.admin.inc#L189 when CViTjs is not in the libraries folder.
If you accidentally leave a carriage return after the sequence that gets cut-and-pasted into the form, you get an error message indicating that the sequence is not properly formatted. I'm sure it makes some people want to pull their hair out trying to figure out what's wrong with the sequence.
I have built a database platform based on tripal.
I created a test user
In the test user front-end, you can upload the query and target file of blast, so that the task submission is successful.
1 When I am in the management interface login an administrator
Click execute to execute the task, and the user will also see the results of the blast.
2 But when using Linux command line, I typed :
drush trp-run-jobs --username=nd343 --root=/var/www/drupal_2023_1011/web --parallel=1
When executing this command, it will be displayed
Executing the following BLAST command:
'/usr/bin/blastn' -query '/tmp/Garlic.chloroplast.genome.fasta' -db '/tmp/Garlic.chloroplast.genome_0.fasta' -out 'sites/default/files/tripal/tripal_blast/2023Oct31_112218.blast.asn' -outfmt=11 -'max_target_seqs' '500' -'evalue' '0.001' -'word_size' '11' -'gapopen' '5' -'gapextend' '2' -'penalty' '-2' -'reward' '1' -num_threads '12'
Command line argument error: Argument "query". File is not accessible: `/tmp/Garlic.chloroplast.genome.fasta'........
3 when using Linux command line, I typed
trpjob-daemon start
to automatically execute the blast job and display the same error.
Executing the following BLAST command:
'/usr/bin/blastn' -query '/tmp/Garlic.chloroplast.genome.fasta' -db '/tmp/Garlic.chloroplast.genome_0.fasta' -out 'sites/default/files/tripal/tripal_blast/2023Oct31_112218.blast.asn' -outfmt=11 -'max_target_seqs' '500' -'evalue' '0.001' -'word_size' '11' -'gapopen' '5' -'gapextend' '2' -'penalty' '-2' -'reward' '1' -num_threads '12'
Command line argument error: Argument "query". File is not accessible: `/tmp/Garlic.chloroplast.genome.fasta'........
I think it's an issue with file permissions.
perhaps I need Change PrivateTmp=true to PrivateTmp=false, But I don't know which file I need to modify.
Trying to access admin/tripal/extension/tripal_blast_analysis/configuration
otice: Undefined index: tripal_analysis_blast_settings_form in drupal_retrieve_form() (line 807 of /Users/chet/UTK/tripal/includes/form.inc).
Warning: call_user_func_array() expects parameter 1 to be a valid callback, function 'tripal_analysis_blast_settings_form' not found or invalid function name in drupal_retrieve_form() (line 842 of /Users/chet/UTK/tripal/includes/form.inc)
```
There are javascript issues on the Tripal Blast UI overview.
In the following screenshot,
Specifically, the following issues are shown in the developer console:
There is a known problem that if a user has a large blast result XML file (exact size depends on your web server) they might end with a memory exhausted WSOD. This is due to the XML reader we use reading the entire file into memory.
We have mostly mitigated this issue by checking the number of hits using grep and then only reading the XML if it is below a static threshold (currently 500). However, there appear to be some edge-cases that this still happens in and of course, if your particular server has issues with even 500 hits then this will still be a problem.
Furthermore, since we simply just don't read the XML we can't even show you a subset of hits or a summary which would be more useful in the case of large resultsets then simply forcing the user to download TSV and go from there.
In the future I would like to move to a stream-based XML reader (http://php.net/manual/en/class.xmlreader.php) to completely remove this issue.
When using tripal blast, I am getting this error
Command line argument error: Argument "out". File is not accessible: `sites/default/files/tripal_blast/2024Apr23_120612.blast.asn'
The folder 'sites/default/files/tripal_blast/' exists but files are not getting created in it.
Even when I try manually in cmd line using
/usr/local/lib/ncbi-blast-2.15.0+/bin/blastn -query '/tmp/Citrus_sinensis-orange1.1g015632m.g.fasta' -db '/var/www/html/teak-wood-genes-drupal7-test/sites/default/files/blast_db_citrus/citrus_whole_genome_shotgun_chr_2021' -out '/var/www/html/teak-wood-genes-drupal7-test/sites/default/files/tripal_blast/2024Apr23_113842.blast.asn' -outfmt=11 -max_target_seqs 10 -evalue 0.001 -word_size 11 -gapopen 5 -gapextend 2 -penalty -2 -reward 1 -num_threads 1
I get the same error and blast web page says "unable to load your BLAST results."
Steps I followed:
I created the database directory using
sudo /usr/local/lib/ncbi-blast-2.15.0+/bin/makeblastdb -in ../Citrus_sinensis_isolate_HZAU_DHSO_2021_chromosome_1_whole_genome_shotgun_sequence.fasta -dbtype nucl -out citrus_whole_genome_shotgun_chr_2021
and then ran the blast. I crosschecked the file paths and even set some file permissions
sudo chown -R www-data:www-data /var/www/html/teak-wood-genes-drupal7-test/sites/default/files
sudo chmod -R 775 /var/www/html/teak-wood-genes-drupal7-test/sites/default/files/tripal_blast/
but nothing works.
The file paths are as given
These are the samples of files I am using
CM030740.1 Citrus sinensis isolate HZAU_DHSO_2021 chromosome 1, whole genome shotgun sequence
AATTTTACCATTAAACATTTAGTTAATTGGAATATGAAGTTTAGGACCGCCAACTTCATATTGTAATGCT
CTAGTTAATAATTAAAATTTTATTAAGTTAGTGATTGTAGATTTCATGTTAACATTAGAAGGGTGGAATT
ATTTTAGGTTCAATAATAATGGTTTCATGTTATAGTCAATGATTTTAGGTTAAACATTTAGAATATTTTT
AGTTAATGGTCTGTAAATATACGGATGTGATGTTTCGGGTTCAGTGTCGTACTCAAAGTAAGACTGTAAT
ATACTTTGTTCTCTAGTATATAGTGATTATACATATATCAATGCATACTAAGTTAAACTCTATTAAAAAA
TGCATGGAACAAGCTCGTGGATGGTGCAAGGTTGTATTGCATTAAATTACTTTTCATGTTACATAAATAT
AATATTGTAGTCGACGTTATTATCCTATATTATAATAACTAATAAAAATGATTATTCAGTTTCTTATAAT
ATAATAAGCTTAAACTATATAACAACATATTGTAATATTTAATTATTTATTAATGGTTTAGTATTACGTT
AAAACATTTCGCAAGCCAATAGCCTAATATAACTATTTGTAGGTTTAATTAAAAAATGAATAACAAACCC
CGCAAATATTAATGCATCTAAAATAGTATGAATTTAATTTGAACGGTATTATATAAACTATAAATATAGC
ATAAAATTTAATTTGTTAAATAATACAGTTCATAATTATTCGAAAACAATGATATATCATAATACAATTC
AAGATAATGCAATATAGCCAAAAAAATTATGTTAATAGTCCACAGTGCTTACAATTGAATATGTTGTAAT
GTTAATTGTAACTGTCTCATTTTTATTTTTTTAATGATTAAATACAATAACATAAAATTAATATATTTAA
AAATGGATATTATATTTCAATAATGATTTCAAATCTATTTGTTACTATGAAAATAATTAATGGACTATGA
ATTGTAGGAATTGAATTACATAAAATATAGTTACTCTAATTACTATCTTATTCTAAAAAACAAAATTAGA
ATTATTTTTCTTTAAAAAATGCTATAACTTTAAAATCCAGCTTATTTGCCAAAATCTTCCCATTTTTTGG
TTCGCCCTCCACAAAAGGGCTTCAAGCCTGTTGATTAGGTTGCCCAACATTCTAAACAAAACAATTCAGC
CGTTGTTCCATCCATTATCACTTCTGGACATATTAAATATCATCCATTAGATAAGATTTTAACATATTCA
GTGGTTGAGATTTTGTTGACTGTAAGTTACATTTAACGTAACTTAGGGATTGCCTACAAAAATGAAGCTA
scaffold00001 length=5927163
TTTTGTATTCTATGTCCTCTGATCTTTATACTTCTTCATTTTGTCTTTGCAAGAACCGGA
ATTATGGGTACATCACAAATTCTCTAGGTGTGACTTGTGTTGTGGGGCCTTTTTTTtACA
TTTCCATATTGCAAGTATTTTTTTGCTACCATTGGTATATTTGTCTGTTAAAATCAATCT
GCTTTCACTTATGTTCGTGCGTTCTTGTTCCCTCGCCTTGCAATTGCATATCTCAAATTA
TCTTTCTTACTTTGATTTAGATGGCCAAGGTTTTAAGCTAACTTTTTACAATGCCAATTT
TTAAATGGTTTTCTAATGCTGTTCAAAGTTGCAGCCTTTACTTCGTATATTTGTCAGGTT
CTGACGGGTGCGGTCGGCGGCGGGGGCTATAGCATGCGGTCTCGAGAGCCGCAAAGAAAA
ATGGGTGGTTTTCCCGGTTTCGGCCATAACTCGTGATCGGGGCCTCCGATTCTGGTTCCG
TTTCGTCCCACGGGACCAGCCGGGCGGGGGCATCGGATTGCAAAAGTCTTTAAATTTGAA
TTTGATTTAAGTTTATATAGTTTGAACACAAAAACTAGCCATTACGGACAAAAACAACAA
ATAGTCGGCTAGCCTATTAATTAGCCAGATCGCCTCTTAATACAGTGCAAGTTACCGTTG
CAATTTGAATTTTGCTGCAGTGATGCTATAGTAACACTATTTTTtAAAATTTCATTGTTA
CCTAAAACTTTTTTATAATTTGACTATGACCCAAAATGTCATAAAATTTTGCAAATATAT
CAAATTTCAGAATTTCTAAATAATGCGCGTTATTCTTAAAACTTTTTGAAATTATGCTAT
GGCCTAAAACTTTATAATATTTTTCAAAGAGATTCTTCTCAGAATTTTAACATAATGCTT
ATTTATTTCAAAGTTCCCAAAATCTTTTTCAGTTTAATCCAAACTTTGAAAAACACTCAA
ATCCTCAAAATACTCGTCTTATAAATATAAAATCTTTTTGTTTATAAAAAGTAATGATTT
ATTAAATAAAATCTTGAGCTTTTTCAATGCTAAACTATACATATATCAAATCATACTGGC
TTTATAAGAATTTGTTGCAATAATGACTCCGCAGAGCTAAACTTTGCTCTTGATCAAGCC
Note: If I use the makeblastdb command without sudo and run the blast, it is running indefinitely and is not even showing a results page
This is similar to what was mentioned in issue #73 (comment) but does not seem to involve tmp.
blastn -max_target_seqs 50 -evalue 0.001 -word_size 11 -gapopen 5 -gapextend 2 -penalty -5 -reward 4 -culling_limit 0
the blast job will fail with
Error: Gap existence and extension values 5 and 2 are not supported for substitution scores 4 and -5
6 and 5 are supported existence and extension values
5 and 5 are supported existence and extension values
4 and 5 are supported existence and extension values
3 and 5 are supported existence and extension values
12 and 8 are supported existence and extension values
Any values more stringent than 12 and 8 are supported
on the server, but the user will not know that their job failed because of the options they chose.
I can make a PR that will prevent this configuration at validation
This advanced option was removed ( see PR #33), but we might want it back some day.
For example:
/*eksc: remove this as it is either the same as max_target_seqs, or miss-implemented
as culling_limit, which is something else entirely
$form['ALG']['GParam']['qRange'] = array(
'#type' => 'textfield',
'#title' => t('Max matches in a query range'),
'#default_value' => $defaults['qRange'],
'#size' => 12,
'#maxlength' => 20,
'#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
);
*/
Its available as an advanced option on ncbi's blast instance as follows:
I don't know how this used to work. It doesn't appear to be possible to turn on the "FASTA header format" section.
When a new BLAST database node is started, the default linkout type is 'none', so the "FASTA header format" section is turned off, since 'none' doesn't require a regex. Changing the linkout type to, for example, 'Generic', does not activate the "FASTA header format" section. Saving the linkout type 'Generic' without setting the FASTA header information results in an invalid blastdb record which then has to be repaired by hand.
This problem is recent. We last built BLAST database nodes about two-three months ago with no problems.
A user was confused because their blast results had over 500 results, and therefore no results were displayed.
After some fiddling I discovered that you can set the max target sequences in the advanced options to return 500 or fewer sequences (see below).
Rather than return no results, why not return the first 500 results and display a warning that there are more results?
default blast parameters: error, 500+ sequences
max target = 50
edit:
Also, the error message reads
We have provided the result files for Download at the top of this page; however, we suggest you re-submit your query using a more stringent e-value (i.e. a smaller number).
However, no download link is provided. Note that the link is provided if < 500 entries
I have set up tripal_blast module for tripal 3. After running each blast, I get an error saying
"We encountered an error and are unable to load your BLAST results."
and I cannot perform the blast analysis
What could be the reason?
We are applying for the Gold-level badge for Tripal Blast as we meet the following requirements. I have provided examples below to make review easier.
Repository: https://github.com/tripal/tripal_blast/
Requirement | Status |
---|---|
Has a public release. | Yes |
Should install on a Tripal site appropriate for the versions it supports. | Yes |
Defines any custom tables or materialized views in the install file (if applicable). | Yes |
Adds any needed controlled vocabulary terms in the install file (Tripal3). | Not Applicable (No cvterms needed.) |
Provides Installation and admin instructions README.md (or RTD). | Yes |
Has a license (distributed with module). | Yes |
Requirement | Status |
---|---|
Follows basic Drupal Coding standards; specifically, code format and API documentation. | Yes |
Uses Tripal API functions. Specifically, it should use the Chado Query API for querying chado (if using chado as the storage system). | Yes (e.g. chado.db for linkouts) |
Tripal Jobs API for long running processes. | Yes |
TripalField class to add data to pages (Tripal3). | Not Applicable |
Provides ways to customize the module (e.g. drush options, field/formatter settings, admin UI). | Yes (e.g. admin UI, custom linkouts hook) |
Latest releases should follow Drupal naming best practices. e.g. first release for Drupal 7 should be: 7.x-1.x. | Yes (e.g. 7.x-1.3) |
Requirement | Status |
---|---|
Extensive documentation for the module (similar to Tripal User’s Guide). | Yes, RTD |
Unit testing is implemented using PHPUnit with the TripalTestSuite or something similar. | Yes, TripalTestSuite |
Continuous integration is setup (e.g. such as with TravisCI). | Yes, TravisCI |
Imports data via Tripal’s importer class (Tripal3). | Not Applicable (doesn't import data) |
Tripal 3 fields are Fully compatible with web services. | Not Applicable (no TripalFields) |
The elementInfo function is fully implemented. | Not Applicable (no TripalFields) |
The query and queryOrder functions fully implemented. | Not Applicable (no TripalFields) |
Web Services uses Tripal’s Web Service Classes (Tripal3). | Not Applicable (no WebServices) |
Code sniffing and testing coverage reports (optional but encouraged). | Yes |
Drupal.org vetted release (optional but encouraged). | Yes |
NOTE: This PR was made using the following template
I wanted to draw attention to the fact that the max_target_seqs parameter is poorly documented by NCBI, leading to misuse. Here are some relevant articles:
https://academic.oup.com/bioinformatics/article/35/9/1613/5106166, https://blastedbio.blogspot.com/2018/11/blast-max-alignment-limits-repartee-one.html
Would it be worthwhile to add additional information regarding the parameter's functionality, similar to the e-Value field? Or perhaps change the hover over text displayed?
Is it possible to add the ability to modify the queue priority of a BLAST job?
Perhaps it would be better if that is a system-wide functionality for all the Tripal queued processes?
Thank you!
Tripal Test Suite has adding an easy method to authenticate Drupal users: tripal/TripalTestSuite#49 (comment). We should use this method to test the blastdb form.
So we added an authentication method that takes out all of the cumbersome work of authenticating and reverting to anonymous. It also manages the session state correctly as recommended by Drupal.
Documentation here: https://github.com/statonlab/TripalTestSuite#user-authentication
A declarative, efficient, and flexible JavaScript library for building user interfaces.
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
An Open Source Machine Learning Framework for Everyone
The Web framework for perfectionists with deadlines.
A PHP framework for web artisans
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
Some thing interesting about web. New door for the world.
A server is a program made to process requests and deliver data to clients.
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
Some thing interesting about visualization, use data art
Some thing interesting about game, make everyone happy.
We are working to build community through open source technology. NB: members must have two-factor auth.
Open source projects and samples from Microsoft.
Google ❤️ Open Source for everyone.
Alibaba Open Source for everyone
Data-Driven Documents codes.
China tencent open source team.