Code Monkey home page Code Monkey logo

proformajava's Introduction

ProFormaJava

ProFormaJava has Java utility classes that parse strings to produce a ProForma string.

Usage Examples

# returns 'SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK'
ProFormaParser parser = new ProFormaParser();
ProFormaTerm term = parser.parseString("[Acetyl]-S[Phospho|+79.966331]GRGK[Acetyl|UNIMOD:1|+42.010565]QGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKT[UNIMOD:21]ESHHKAKGK");
System.out.println(term.sequence);

# returns 'MTLFQLREHWFVYKDDEKLTAFRNKSMLFQRELRPNEEVTWK'
term = parser.parseString("MTLFQLREHWFVYKDDEKLTAFRNK[p-adenosine|R:N6-(phospho-5'-adenosine)-L-lysine| RESID:AA0227| MOD:00232| N6AMPLys]SMLFQRELRPNEEVTWK");
System.out.println(term.sequence);

# returns 'MTLFQLDEKLTAFRNKSMLFQRELRPNEEVTWK'
term = parser.parseString("MTLFQLDEKLTA[-37.995001|info:unknown modification]FRNKSMLFQRELRPNEEVTWK");
System.out.println(term.sequence);

proformajava's People

Watchers

 avatar  avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.