Code Monkey home page Code Monkey logo

neuropred-plm's Introduction

NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model

PyPI - Version PyPI - Python Version GitHub - LICENSE PyPI - Downloads

Requirements

To install requirements:

# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM

Usage

import torch
from NeuroPredPLM.predict import predict
data = [
    ("peptide_1", "IGLRLPNMLKF"),
    ("peptide_2", "QAAQFKVWSASELVD"),
    ("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]

device = "cuda" if torch.cuda.is_available() else "cpu" 
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}

License

Released under the MIT license.

Contact

If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at [email protected].

neuropred-plm's People

Contributors

wangleiofficial avatar

Stargazers

 avatar  avatar  avatar  avatar  avatar  avatar  avatar  avatar  avatar  avatar

Watchers

 avatar  avatar

Forkers

rocke2020

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.