Code Monkey home page Code Monkey logo

prekcat's Introduction

We have released a new version of PreKcat, called UniKP, the link is provided on UniKP.

PreKcat

Demo-Preview

Table of contents

Installation

(Back to top)

Notice:

  • You need install pretrained protein language modoel ProtT5-XL-UniRef50 to generate enzyme representation, the link is provided on ProtT5-XL-U50.
  • You need install pretrained molecular language modoel SMILES Transformer to generate substrate representation, the link is provided on SMILES Transformer.
  • You also need install modoel PreKcat_model to predict, the link is provided on PreKcat_model.

other packages:

  • Python v3.6.9 (Anaconda installation recommended)
  • PyTorch v1.10.1+cu113
  • pandas v1.1.5
  • NumPy v1.19.5

Usage

(Back to top)

  • Example for how to predict enzyme turnover number from enzyme sequences and substrate structures by language model, PreKcat:
import torch
from build_vocab import WordVocab
from pretrain_trfm import TrfmSeq2seq
from utils import split
from transformers import T5EncoderModel, T5Tokenizer
import re
import gc
import numpy as np
import pandas as pd
import pickle
import math


def smiles_to_vec(Smiles):
    pad_index = 0
    unk_index = 1
    eos_index = 2
    sos_index = 3
    mask_index = 4
    vocab = WordVocab.load_vocab('vocab.pkl')
    def get_inputs(sm):
        seq_len = 220
        sm = sm.split()
        if len(sm)>218:
            print('SMILES is too long ({:d})'.format(len(sm)))
            sm = sm[:109]+sm[-109:]
        ids = [vocab.stoi.get(token, unk_index) for token in sm]
        ids = [sos_index] + ids + [eos_index]
        seg = [1]*len(ids)
        padding = [pad_index]*(seq_len - len(ids))
        ids.extend(padding), seg.extend(padding)
        return ids, seg
    def get_array(smiles):
        x_id, x_seg = [], []
        for sm in smiles:
            a,b = get_inputs(sm)
            x_id.append(a)
            x_seg.append(b)
        return torch.tensor(x_id), torch.tensor(x_seg)
    trfm = TrfmSeq2seq(len(vocab), 256, len(vocab), 4)
    trfm.load_state_dict(torch.load('trfm_12_23000.pkl'))
    trfm.eval()
    x_split = [split(sm) for sm in Smiles]
    xid, xseg = get_array(x_split)
    X = trfm.encode(torch.t(xid))
    return X


def Seq_to_vec(Sequence):
    sequences_Example = []
    for i in range(len(Sequence)):
        zj = ''
        for j in range(len(Sequence[i]) - 1):
            zj += Sequence[i][j] + ' '
        zj += Sequence[i][-1]
        sequences_Example.append(zj)
    tokenizer = T5Tokenizer.from_pretrained("prot_t5_xl_uniref50", do_lower_case=False)
    model = T5EncoderModel.from_pretrained("prot_t5_xl_uniref50")
    gc.collect()
    print(torch.cuda.is_available())
    # 'cuda:0' if torch.cuda.is_available() else
    device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu')
    model = model.to(device)
    model = model.eval()
    features = []
    for i in range(len(sequences_Example)):
        print('For sequence ', str(i+1))
        sequences_Example_i = sequences_Example[i]
        sequences_Example_i = [re.sub(r"[UZOB]", "X", sequences_Example_i)]
        ids = tokenizer.batch_encode_plus(sequences_Example_i, add_special_tokens=True, padding=True)
        input_ids = torch.tensor(ids['input_ids']).to(device)
        attention_mask = torch.tensor(ids['attention_mask']).to(device)
        with torch.no_grad():
            embedding = model(input_ids=input_ids, attention_mask=attention_mask)
        embedding = embedding.last_hidden_state.cpu().numpy()
        for seq_num in range(len(embedding)):
            seq_len = (attention_mask[seq_num] == 1).sum()
            seq_emd = embedding[seq_num][:seq_len - 1]
            features.append(seq_emd)
    features_normalize = np.zeros([len(features), len(features[0][0])], dtype=float)
    for i in range(len(features)):
        for k in range(len(features[0][0])):
            for j in range(len(features[i])):
                features_normalize[i][k] += features[i][j][k]
            features_normalize[i][k] /= len(features[i])
    return features_normalize


if __name__ == '__main__':
    sequences = ['MEDIPDTSRPPLKYVKGIPLIKYFAEALESLQDFQAQPDDLLISTYPKSGTTWVSEILDMIYQDGDVEKCRRAPVFIRVPFLEFKA'
                 'PGIPTGLEVLKDTPAPRLIKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYRMAKVHPDPDTWDSFLEKFMAGEVSYGSW'
                 'YQHVQEWWELSHTHPVLYLFYEDMKENPKREIQKILKFVGRSLPEETVDLIVQHTSFKEMKNNSMANYTTLSPDIMDHSISAFMRK'
                 'GISGDWKTTFTVAQNERFDADYAKKMEGCGLSFRTQL']
    Smiles = ['OC1=CC=C(C[C@@H](C(O)=O)N)C=C1']
    seq_vec = Seq_to_vec(sequences)
    smiles_vec = smiles_to_vec(Smiles)
    fused_vector = np.concatenate((smiles_vec, seq_vec), axis=1)
    with open('PreKcat_new/PreKcat_model.pkl', "rb") as f:
        model = pickle.load(f)
    Pre_label = model.predict(fused_vector)
    Pre_label_pow = [math.pow(10, Pre_label[i]) for i in range(len(Pre_label))]
    print(len(Pre_label))
    res = pd.DataFrame({'sequences': sequences, 'Smiles': Smiles, 'Pre_label': Pre_label_pow})
    res.to_excel('PreKcat_predicted_label.xlsx')

Development

(Back to top)

Contribute

(Back to top)

Sponsor

(Back to top)

Adding new features or fixing bugs

(Back to top)

License

(Back to top)

GNU General Public License version 3

Footer

(Back to top)

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.